Oportuzumab monatox
Explore a selection of our essential drug information below, or:
Overview
- DrugBank ID
- DB05319
- Type
- Biotech
- Clinical Trials
- Phase 0
- 0
- Phase 1
- 0
- Phase 2
- 3
- Phase 3
- 3
- Phase 4
- 0
Identification
- Generic Name
- Oportuzumab monatox
- DrugBank Accession Number
- DB05319
- Background
VB4-845 is studied in the treatment of certain types of head and neck cancer. VB4-845 is made by linking a monoclonal antibody fragment to a toxic protein that may kill cancer cells. VB4-845 is a fusion protein containing humanized scFv specific for the epithelial cell adhesion molecule, Ep-CAM, a tumor cell-associated target highly expressed on carcinoma cells of epithelial origin and a truncated portion of Pseudomonas exotoxin A.
- Type
- Biotech
- Groups
- Investigational
- Biologic Classification
- Protein Based Therapies
Other protein based therapies - Protein Chemical Formula
- Not Available
- Protein Average Weight
- Not Available
- Sequences
>9045_H|oportuzumab monatox|||SCFV-KAPPA-HEAVY-TOXIN (V-KAPPA(7-118)+LINKER(119-144)+VH(145-260)+TOX-DOMAIN(281-637))|||||||647||||MW 69566.3|MW 69566.3| HHHHHHDIQMTQSPSSLSASVGDRVTITCRSTKSLLHSNGITYLYWYQQKPGKAPKLLIY QMSNLASGVPSRFSSSGSGTDFTLTISSLQPEDFATYYCAQNLEIPRTFGQGTKVELKRA TPSHNSHQVPSAGGPTANSGTSGSEVQLVQSGPGLVQPGGSVRISCAASGYTFTNYGMNW VKQAPGKGLEWMGWINTYTGESTYADSFKGRFTFSLDTSASAAYLQINSLRAEDTAVYYC ARFAIKGDYWGQGTLLTVSSEFGGAPEFPKPSTPPGSSGLEGGSLAALTAHQACHLPLET FTRHRQPRGWEQLEQCGYPVQRLVALYLAARLSWNQVDQVIRNALASPGSGGDLGEAIRE QPEQARLALTLAAAESERFVRQGTGNDEAGAASADVVSLTCPVAAGECAGPADSGDALLE RNYPTGAEFLGDGGDVSFSTRGTQNWTVERLLQAHRQLEERGYVFVGYHGTFLEAAQSIV FGGVRARSQDLDAIWRGFYIAGDPALAYGYAQDQEPDARGRIRNGALLRVYVPRSSLPGF YRTGLTLAAPEAAGEVERLIGHPLPLRLDAITGPEEEGGRLETILGWPLAERTVVIPSAI PTDPRNVGGDLDPSSIPDKEQAISALPDYASQPGKPPHHHHHHKDEL
Download FASTA Format- Synonyms
- Oportuzumab monatox
- External IDs
- VB4-845
Pharmacology
- Indication
Investigated for use/treatment in bladder cancer and head and neck cancer.
Reduce drug development failure ratesBuild, train, & validate machine-learning modelswith evidence-based and structured datasets.Build, train, & validate predictive machine-learning models with structured datasets.- Contraindications & Blackbox Warnings
- Prevent Adverse Drug Events TodayTap into our Clinical API for life-saving information on contraindications & blackbox warnings, population restrictions, harmful risks, & more.Avoid life-threatening adverse drug events with our Clinical API
- Pharmacodynamics
Not Available
- Mechanism of action
VB4-845 binds to EpCAM (a protein on the surface of epithelial cells and some types of cancer cells). Also called anti-EpCAM-Pseudomonas-exotoxin fusion protein and Proxinium. It targets and kills Ep-CAM-positive tumors by apoptosis.
Target Actions Organism UEpithelial cell adhesion molecule Not Available Humans - Absorption
Not Available
- Volume of distribution
Not Available
- Protein binding
Not Available
- Metabolism
- Not Available
- Route of elimination
Not Available
- Half-life
Not Available
- Clearance
Not Available
- Adverse Effects
- Improve decision support & research outcomesWith structured adverse effects data, including: blackbox warnings, adverse reactions, warning & precautions, & incidence rates. View sample adverse effects data in our new Data Library!Improve decision support & research outcomes with our structured adverse effects data.
- Toxicity
Not Available
- Pathways
- Not Available
- Pharmacogenomic Effects/ADRs
- Not Available
Interactions
- Drug Interactions
- This information should not be interpreted without the help of a healthcare provider. If you believe you are experiencing an interaction, contact a healthcare provider immediately. The absence of an interaction does not necessarily mean no interactions exist.Not Available
- Food Interactions
- Not Available
Products
- Drug product information from 10+ global regionsOur datasets provide approved product information including:dosage, form, labeller, route of administration, and marketing period.Access drug product information from over 10 global regions.
- International/Other Brands
- Proxinium / Vicinium
Categories
- ATC Codes
- L01FX16 — Oportuzumab monatox
- Drug Categories
- Chemical TaxonomyProvided by Classyfire
- Description
- Not Available
- Kingdom
- Organic Compounds
- Super Class
- Organic Acids
- Class
- Carboxylic Acids and Derivatives
- Sub Class
- Amino Acids, Peptides, and Analogues
- Direct Parent
- Peptides
- Alternative Parents
- Not Available
- Substituents
- Not Available
- Molecular Framework
- Not Available
- External Descriptors
- Not Available
- Affected organisms
- Not Available
Chemical Identifiers
- UNII
- 945CY7ZMI2
- CAS number
- 945228-48-8
References
- General References
- Not Available
- External Links
- PubChem Substance
- 347910078
- Wikipedia
- Oportuzumab_monatox
Clinical Trials
- Clinical Trials
Clinical Trial & Rare Diseases Add-on Data Package
Explore 4,000+ rare diseases, orphan drugs & condition pairs, clinical trial why stopped data, & more. Preview package Phase Status Purpose Conditions Count Start Date Why Stopped 100+ additional columns Unlock 175K+ rows when you subscribe.View sample data3 Completed Treatment Bladder Cancer 1 somestatus stop reason just information to hide 3 Unknown Status Treatment Non-Muscle-invasive Bladder Cancer (NMIBC) 1 somestatus stop reason just information to hide 2 Completed Treatment Bladder Cancer / Bladder Neoplasm 1 somestatus stop reason just information to hide 2 Terminated Treatment Head And Neck Cancer / Head and Neck Neoplasms / Mouth Neoplasms / Neoplasms, Squamous Cell / Squamous Cell Carcinoma (SCC) / Squamous Cell Carcinoma of the Head and Neck (SCCHN) 1 somestatus stop reason just information to hide 2, 3 Terminated Treatment Head And Neck Cancer / Head and Neck Neoplasms / Mouth Neoplasms / Neoplasms, Squamous Cell / Squamous Cell Carcinoma (SCC) / Squamous Cell Carcinoma of the Head and Neck (SCCHN) 1 somestatus stop reason just information to hide
Pharmacoeconomics
- Manufacturers
- Not Available
- Packagers
- Not Available
- Dosage Forms
- Not Available
- Prices
- Not Available
- Patents
- Not Available
Properties
- State
- Solid
- Experimental Properties
- Not Available
Targets
- Kind
- Protein
- Organism
- Humans
- Pharmacological action
- Unknown
- General Function
- May act as a physical homophilic interaction molecule between intestinal epithelial cells (IECs) and intraepithelial lymphocytes (IELs) at the mucosal epithelium for providing immunological barrier as a first line of defense against mucosal infection. Plays a role in embryonic stem cells proliferation and differentiation. Up-regulates the expression of FABP5, MYC and cyclins A and E
- Specific Function
- cadherin binding involved in cell-cell adhesion
- Gene Name
- EPCAM
- Uniprot ID
- P16422
- Uniprot Name
- Epithelial cell adhesion molecule
- Molecular Weight
- 34932.005 Da
Drug created at November 18, 2007 18:23 / Updated at January 14, 2023 19:04